Back to recipes
Marmalade Toast
Crispy buttered toast topped with bright, bitter-sweet orange marmalade. The perfect quick breakfast or snack to pair with your morning espresso.
- Total time
- 5 min
- Servings
- 1
- Calories
- 165
- Protein
- 3g
quicksimpleamericanvegetariancrispysoftweeknightbrunch
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toast the bread until golden brown and crispy, about 2–3 minutes.
Step 2
Spread butter over the hot toast while it's still warm.
Step 3
Top with a generous spread of orange marmalade.
Step 4
Serve immediately alongside your espresso.
Tools you’ll need
- toaster
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
