Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Memela with Crispy Tasajo

Thick Oaxacan corn cakes topped with crispy shredded dried beef, black beans, and fresh lime. Salty, smoky, and satisfying—ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
18g
25-Min Memela with Crispy Tasajo
comfortrusticmexicanbeefcrispyheartytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering.

  2. Step 2

    Add tasajo to the skillet and cook, stirring often, until it's crispy and darkens, 5–6 minutes.

  3. Step 3

    Transfer tasajo to a plate. Mix masa harina with warm water in a bowl until smooth.

  4. Step 4

    Working in batches, pour 3 tbsp masa into the skillet and flatten into a thick disc with a spatula.

  5. Step 5

    Cook memela 3–4 minutes per side until golden, working in batches. Transfer to a plate.

  6. Step 6

    Top each memela with black beans, crispy tasajo, raw onion, jalapeño, and a squeeze of fresh lime.

Tools you’ll need

  • large skillet (12-inch)
  • mixing bowl
  • spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.