Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Beef Carne Seca

Shredded beef crisped hard in a hot skillet with chiles and cumin—the weeknight version of northern Mexico's legendary dried-beef dish. Ready in under 20 minutes with pantry shortcuts.

Total time
18 min
Servings
3
Calories
385
Protein
38g
Crispy Beef Carne Seca
comfortheartymexicanbeefcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast dried chiles in a dry skillet over medium heat for 90 seconds until fragrant. Remove and let cool, then crumble by hand into small pieces.

  2. Step 2

    Heat 2 tbsp olive oil in the same skillet over medium-high until shimmering. Add onion and jalapeño, stir for 2 minutes until softened.

  3. Step 3

    Add shredded beef, crumbled chile, and cumin. Stir constantly, breaking up clumps, for 6-8 minutes until beef is golden and crispy on edges.

  4. Step 4

    Squeeze half the lime over the beef. Season with salt and pepper to taste. Toss once and slide onto a plate.

  5. Step 5

    Cut remaining lime into wedges. Serve the carne seca with lime wedges and warm tortillas.

Tools you’ll need

  • 12-inch skillet or comal
  • wooden spoon or spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.