Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Minute Milk Tea with Boba

Chilled Taiwanese milk tea loaded with chewy tapioca pearls—ready in minutes using brewed tea, sweetened condensed milk, and ice. No stove required.

Total time
5 min
Servings
2
Calories
280
Protein
4g
5-Minute Milk Tea with Boba
refreshingcasualtaiwanesevegetariancreamychewyweeknightsummer

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Divide ice and cooked tapioca pearls between two tall glasses, about 1/4 cup pearls per glass.

  2. Step 2

    Pour cooled tea evenly into both glasses, filling them about halfway.

  3. Step 3

    Add 1/4 cup sweetened condensed milk to each glass, stirring to combine.

  4. Step 4

    Top each glass with 2 tablespoons whole milk or cream for a signature marbled swirl.

  5. Step 5

    Insert a wide straw, stir once, and serve immediately.

Tools you’ll need

  • two tall glasses
  • wide bubble tea straw
  • spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.