Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Moroccan Sardine Kefta

Pan-fried sardine patties spiced with cumin, paprika, and cilantro, inspired by traditional Moroccan kefta. Crispy outside, tender inside—ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
285
Protein
18g
Moroccan Sardine Kefta
rusticcasualmoroccanfishcrispytenderweeknightappetizer

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place the drained sardines in a medium bowl, breaking them apart with a fork into flaked pieces the size of pea halves, about 1 minute of gentle pressing.

  2. Step 2

    Mince the onion into pieces smaller than a grain of rice—about pencil-tip dots—until you have roughly 3 tablespoons of onion.

  3. Step 3

    Mince the garlic until the pieces are smaller than a grain of rice, about the size of pencil-tip dots, yielding roughly 1 teaspoon.

  4. Step 4

    Finely chop the cilantro by slicing the leaves lengthwise into thin strips, then crossing those strips with perpendicular cuts until pieces are pencil-tip size.

  5. Step 5

    Add the minced onion, minced garlic, chopped cilantro, ground cumin, paprika, and breadcrumbs to the bowl with the flaked sardines.

  6. Step 6

    Mix gently with a fork, stirring in one direction until the ingredients are evenly distributed and the mixture holds together loosely, about 1 minute.

  7. Step 7

    Divide the mixture into 8 equal portions, then shape each portion between your palms into a small oval patty about the size of a golf ball, roughly 2 inches long and 0.75 inches thick.

  8. Step 8

    Heat 3 tablespoons of olive oil in a 10-inch nonstick skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  9. Step 9

    Carefully lay the 8 sardine patties in the hot oil in a single layer—they should sizzle loudly on contact.

  10. Step 10

    Cook without moving the patties for 3 to 4 minutes, until the undersides turn the color of warm honey with darker edges.

  11. Step 11

    Using a thin metal spatula, carefully flip each patty to the other side, working quickly so the oil stays hot.

  12. Step 12

    Cook the second side for 2 to 3 minutes until it also turns golden-honey colored with darker edges and feels slightly firm when pressed gently.

  13. Step 13

    Transfer the cooked patties to a clean plate lined with paper towels to drain excess oil, about 1 minute.

Tools you’ll need

  • medium mixing bowl
  • fork
  • cutting board
  • chef's knife
  • 10-inch nonstick skillet
  • thin metal spatula
  • paper towels
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.