Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Msemen with Honey and Butter

Crispy, flaky Moroccan pastry layered with butter and folded into a square, then pan-fried until golden and drizzled with warm honey. A showstopping vegetarian main or rich snack.

Total time
50 min
Servings
4
Calories
520
Protein
8g
Msemen with Honey and Butter
indulgentrusticmoroccanvegetarianvegetariancrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Add warm water slowly, stirring until a shaggy dough forms.

  2. Step 2

    Knead dough on an oiled surface for 5 minutes until smooth and supple.

  3. Step 3

    Divide dough into 4 equal balls. Brush each with a tiny bit of butter, cover with plastic.

  4. Step 4

    Let rest at room temperature for 15 minutes until dough relaxes.

  5. Step 5

    On an oiled work surface, stretch one dough ball into a thin square, almost transparent.

  6. Step 6

    Spread 1 tbsp melted butter across the dough. Fold into thirds, then fold thirds again to form a square.

  7. Step 7

    Repeat with remaining dough balls and butter. Let folded squares rest 5 minutes.

  8. Step 8

    Heat olive oil in a large skillet over medium-high until it shimmers, about 1 minute.

  9. Step 9

    Pan-fry one msemen until deep golden brown and crispy on the bottom, 3–4 minutes.

  10. Step 10

    Flip and cook the second side until golden, another 2–3 minutes. Transfer to a plate.

  11. Step 11

    Repeat with remaining msemen, adding 0.5 tbsp oil between batches if needed.

  12. Step 12

    Warm honey in a small pot over low heat with cinnamon, 1–2 minutes until fragrant.

  13. Step 13

    Arrange msemen on a serving plate. Drizzle warm honey over top and sprinkle sesame seeds.

  14. Step 14

    Serve immediately while still warm and crispy.

Tools you’ll need

  • medium mixing bowl
  • wooden spoon
  • work surface
  • plastic wrap
  • 12-inch nonstick skillet or cast iron
  • small pot
  • wide spatula
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.