Back to recipes
Mushroom Rice Bowl
A comforting bowl of steamed rice topped with savory sliced mushrooms, fresh green onions, and tangy shredded red ginger. Simple, quick, and full of umami.
- Total time
- 15 min
- Servings
- 2
- Calories
- 350
- Protein
- 8g
comfortingJapaneseveganvegetariandairy-freemushroomtenderchewy
Ingredients
9 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Heat oil in a skillet over medium-high heat.
Step 2
Add sliced mushrooms and cook until browned, about 5 minutes.
Step 3
Stir in soy sauce, mirin, salt, and pepper; cook for 1 minute.
Step 4
Divide warm rice between two bowls.
Step 5
Top each bowl with the mushroom mixture.
Step 6
Garnish with sliced green onions and shredded red ginger.
Tools you’ll need
- skillet
- spatula
- knife
- cutting board
- measuring cups
- measuring spoons
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
