Back to recipes
Mushroom Rice Bowl
A comforting bowl of steamed rice topped with savory sliced mushrooms, fresh green onions, and tangy shredded red ginger. Simple, quick, and full of umami.
- Total time
- 15 min
- Servings
- 2
- Calories
- 350
- Protein
- 8g
comfortingJapaneseveganvegetariandairy-freemushroomtenderchewy
Ingredients
9 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Heat oil in a skillet over medium-high heat.
Step 2
Add sliced mushrooms and cook until browned, about 5 minutes.
Step 3
Stir in soy sauce, mirin, salt, and pepper; cook for 1 minute.
Step 4
Divide warm rice between two bowls.
Step 5
Top each bowl with the mushroom mixture.
Step 6
Garnish with sliced green onions and shredded red ginger.
Tools you’ll need
- skillet
- spatula
- knife
- cutting board
- measuring cups
- measuring spoons
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
