Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Nasi Lemak Ayam Goreng — Coconut Rice & Crispy Chicken

Fragrant coconut rice paired with crispy fried chicken, hard-boiled egg, fried anchovies, peanuts, fresh cucumber, and fiery sambal. A complete Malaysian dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
720
Protein
48g
Nasi Lemak Ayam Goreng — Coconut Rice & Crispy Chicken
comfortsatisfyingmalaysianchickencrispytenderfluffyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil 2 eggs in salted water until hard-boiled, about 10 minutes. Transfer to ice water while you start the chicken.

  2. Step 2

    Pat chicken thighs dry and season generously with salt and pepper. Heat 2 tbsp neutral oil in a large skillet over medium-high heat.

  3. Step 3

    Once oil shimmers, lay chicken skin-side down and sear without moving for 5 minutes until golden and crispy.

  4. Step 4

    Flip chicken and cook 4 more minutes until cooked through. Remove and set aside; keep the skillet and oil.

  5. Step 5

    Warm cooked rice with 0.5 cup coconut milk in the same skillet over low heat for 2 minutes, stirring gently to combine.

  6. Step 6

    Peel eggs, halve cucumber into slices. Plate coconut rice, top with chicken, egg, fried anchovies, peanuts, cucumber, and sambal.

Tools you’ll need

  • large skillet (12-inch)
  • tongs
  • small pot for boiling eggs
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.