Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Nasi Lemak Ayam

Fragrant coconut rice with crispy pan-fried chicken, served with a vibrant sambal and fresh cucumber. A Malaysian comfort classic that tastes restaurant-quality but cooks in under 45 minutes.

Total time
45 min
Servings
2
Calories
620
Protein
32g
Nasi Lemak Ayam
comfortsatisfyingmalaysianchickencrispyfluffytenderweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the jasmine rice in a fine-mesh strainer under cold running water, stirring gently with your fingers until the water runs mostly clear, about 1 minute; this removes excess starch so the rice will be fluffy, not sticky.

  2. Step 2

    Pat the chicken thighs dry with paper towels, pressing gently to remove surface moisture so they will brown evenly and crisply when cooked.

  3. Step 3

    Slice the red chilies lengthwise from tip to stem, keeping them open like a boat; remove the white seeds and pale ribs inside using the tip of a small spoon, then mince the chili flesh into pieces smaller than a grain of rice.

  4. Step 4

    Mince the garlic cloves until the pieces are smaller than a grain of rice, about the size of pencil-tip dots; this releases the most flavor when cooked.

  5. Step 5

    Peel the shallot and mince it until the pieces are the same size as the garlic, smaller than a grain of rice.

  6. Step 6

    Cut the cucumber in half lengthwise (tip to root), then slice each half crosswise into thin half-moons about 1/8-inch thick; place in a small bowl and set aside.

  7. Step 7

    Heat 1 tablespoon of oil in a small saucepan over medium heat until it shimmers and slides quickly when you tilt the pan, about 60 seconds.

  8. Step 8

    Add the minced shallot and garlic to the hot oil and stir constantly for 90 seconds until the mixture turns light golden and smells strong and fragrant.

  9. Step 9

    Stir in the minced chili and cook, stirring constantly, for another 30 seconds until the raw chili smell fades and the mixture looks uniform in color.

  10. Step 10

    Squeeze the lime juice into the saucepan and stir to combine; season with a pinch of salt and set the saucepan aside on the counter to cool.

  11. Step 11

    Heat 2 tablespoons of oil in a medium saucepan over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  12. Step 12

    Add the dried chicken thighs to the hot oil in a single layer; do not stir for 4 minutes so the undersides develop a golden-brown crust.

  13. Step 13

    Flip each thigh over and cook for another 3–4 minutes until the other side turns golden brown and the internal temperature reaches 165°F on a meat thermometer.

  14. Step 14

    Transfer the cooked chicken to a cutting board and let it rest for 2 minutes, then cut it into bite-sized pieces (roughly 1.5-inch chunks).

  15. Step 15

    Without washing the saucepan, pour in the rinsed rice and stir for 45 seconds, scraping up any stuck-on brown bits from the bottom, to toast the rice slightly.

  16. Step 16

    Pour in the coconut milk and 1.25 cups of water; stir once to combine, then bring to a boil over medium-high heat, about 90 seconds.

  17. Step 17

    Lower the heat to low, cover the saucepan with a tight-fitting lid, and simmer without lifting the lid for 15 minutes until the liquid is fully absorbed.

  18. Step 18

    Remove the lid and let the rice rest, uncovered, for 2 minutes; the surface should look dry and grains should be separate and fluffy.

  19. Step 19

    Fluff the rice gently with a fork, breaking up any clumps, then divide it between two bowls or plates in equal portions.

  20. Step 20

    Top each portion of rice with half of the chicken pieces, arranged in a loose mound in the center.

  21. Step 21

    Spoon half of the sambal alongside the rice, then arrange half of the cucumber slices on the opposite side of the plate to create three distinct sections.

  22. Step 22

    Taste and adjust salt and pepper if needed; serve immediately while the rice and chicken are still warm.

Tools you’ll need

  • fine-mesh strainer
  • paper towels
  • small knife
  • small spoon
  • medium saucepan with tight-fitting lid
  • small saucepan
  • wooden spoon or rubber spatula
  • meat thermometer
  • cutting board
  • fork
  • two serving bowls or plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.