Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Neua Pad Prik — Thai Beef & Chili

Thin-sliced beef and fresh chilis seared hot and fast in a Thai-style stir-fry with soy, garlic, and a touch of fish sauce. Ready in under 10 minutes, salty-spicy-bright, and utterly addictive.

Total time
10 min
Servings
2
Calories
385
Protein
42g
10-Min Neua Pad Prik — Thai Beef & Chili
quickboldthaibeeftendercrispyweeknightstir-fry

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice beef thinly against the grain, about 1/8-inch thick. Slice chilis lengthwise; mince garlic.

  2. Step 2

    Heat oil in a 12-inch skillet over high heat until it shimmers and wisps of smoke appear, ~90 seconds.

  3. Step 3

    Add beef in a single layer and sear without stirring until edges brown, ~60 seconds. Stir and cook another 60 seconds.

  4. Step 4

    Push beef to the side. Add garlic to the empty space, cook 30 seconds until fragrant, then toss together.

  5. Step 5

    Add chilis, soy sauce, and fish sauce. Toss constantly for 60 seconds until chilis soften and sauce coats the beef.

  6. Step 6

    Serve immediately in a bowl or over rice.

Tools you’ll need

  • 12-inch skillet or wok
  • cutting board
  • sharp knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.