Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Onion Uttapam

Crispy-edged Indian savory pancakes topped with caramelized onions and fresh herbs. Made from a simple fermented rice-and-lentil batter, uttapam comes together in 25 minutes and delivers restaurant-quality results at home.

Total time
40 min
Servings
2
Calories
285
Protein
6g
Onion Uttapam
comfortwholesomeindianvegetarianvegetariancrispyfluffyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Measure 0.75 cup rice and 0.25 cup urad dal into a bowl and rinse both separately under cold running water until the water runs clear, stirring gently with your fingers to remove dust and debris.

  2. Step 2

    Soak the rinsed rice and urad dal together in a bowl covered with water by 2 inches for 4 hours, or overnight at room temperature — the longer soak gives a fluffier batter.

  3. Step 3

    Drain the soaked rice and dal completely in a colander, shaking gently to remove excess water.

  4. Step 4

    Pour the drained rice and dal into a blender with 0.75 cup water, a 0.5-inch piece of peeled ginger, and 1 green chili if using — blend on high speed for 6–8 minutes until smooth and slightly frothy, scraping the sides once halfway through.

  5. Step 5

    Transfer the batter to a bowl and stir in 0.75 teaspoon salt until evenly mixed — the batter should pour easily, like thick yogurt.

  6. Step 6

    Peel 2 onions and slice each one in half from root to tip, then place each half flat on the cutting board and slice crosswise into thin half-moons, about 1/8-inch thick.

  7. Step 7

    Chop 3 tablespoons of fresh cilantro or parsley into small pieces about the size of rice grains.

  8. Step 8

    Heat a 10-inch non-stick skillet or cast iron pan over medium heat and add 1 tablespoon of oil — wait 30 seconds until the oil flows freely when you tilt the pan.

  9. Step 9

    Pour 0.5 cup of the batter onto the center of the hot pan and use the back of a wet spoon to spread it outward in a circular motion, making a thin even disc about 7 inches wide and 0.25-inch thick.

  10. Step 10

    Scatter a handful of the sliced onions (about 3 tablespoons) evenly across the top of the batter, pressing gently so they stick to the wet surface.

  11. Step 11

    Sprinkle 1 tablespoon of chopped cilantro over the onions and let the uttapam cook without moving it for 3–4 minutes, until the bottom turns golden-brown and the edges pull away slightly from the pan.

  12. Step 12

    Drizzle 0.5 tablespoon of oil around the edges of the uttapam and slide a spatula underneath to loosen it, then flip it carefully onto the other side — the surface should be firm enough to hold together.

  13. Step 13

    Cook the flipped side for 2–3 minutes until the bottom is also golden-brown and the edges feel crisp when you touch them with a fork.

  14. Step 14

    Slide the uttapam onto a plate and repeat steps 9–13 with the remaining batter, using 1 tablespoon of oil for each new uttapam — you will make 3–4 total.

Tools you’ll need

  • rice-measuring cup
  • bowl for soaking
  • colander
  • blender
  • 10-inch non-stick skillet or cast iron pan
  • rubber or silicone spatula, non-metal preferred
  • wooden spoon for spreading

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.