Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Aloo Paratha

Crispy, golden Indian flatbread stuffed with spiced mashed potatoes. Cooked on a skillet until the exterior is flaky and the filling is steaming hot.

Total time
35 min
Servings
2
Calories
385
Protein
8g
Aloo Paratha
comfortwholesomeindianvegetarianvegetariancrispyfluffytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place the 2 potatoes in a pot and cover with cold water by 1 inch. Set the pot on the stove over high heat and bring the water to a rolling boil, about 8 minutes.

  2. Step 2

    Reduce heat to medium and simmer until a fork slides easily through the center of a potato, about 12 minutes more. Drain the potatoes in a colander.

  3. Step 3

    Let the potatoes cool for 2 minutes, then peel away the skin with your fingers or a vegetable peeler and discard it.

  4. Step 4

    Place the peeled potatoes in a bowl and mash with a fork until mostly smooth, leaving a few small lumps. Measure out salt and pepper into separate small bowls.

  5. Step 5

    In a medium bowl, pour the 1.5 cups flour and 0.5 cup water together. Mix with your hands or a wooden spoon until a soft, slightly sticky dough forms, about 1 minute.

  6. Step 6

    Knead the dough in the bowl by pushing it away from you with the heel of your hand, folding it back over itself, rotating the bowl slightly, and repeating for 3 minutes until smooth and elastic.

  7. Step 7

    Season the mashed potatoes with 0.5 teaspoon cumin seeds, a pinch of salt, and a pinch of pepper. Stir until the cumin is evenly distributed.

  8. Step 8

    Divide the dough into 4 equal pieces and roll each between your palms into a ball about the size of a golf ball.

  9. Step 9

    On a lightly floured work surface, use a rolling pin to flatten one dough ball into a thin round about 6 inches wide and 1/8 inch thick, rotating after each roll.

  10. Step 10

    Spoon 2 tablespoons of the spiced potato mixture into the center of the round. Fold the edges up and over the filling toward the center, pinching them closed, then gently flatten into a disk.

  11. Step 11

    Using the rolling pin, gently flatten the stuffed paratha into a round about 7 inches wide, 1/4 inch thick. Repeat steps 9–11 with the remaining dough balls and filling.

  12. Step 12

    Place a 12-inch nonstick skillet or griddle over medium-high heat and let it warm until a drop of water sizzles and evaporates in under 2 seconds, about 1 minute.

  13. Step 13

    Lay one paratha on the hot skillet. Cook until the bottom is spotted with light brown marks and the edges look set, about 2 minutes.

  14. Step 14

    Flip the paratha over using a metal spatula. Drizzle 0.5 tablespoon ghee or butter directly onto the surface.

  15. Step 15

    Cook the second side until it develops brown spots and looks crispy, about 2 minutes, then slide onto a plate.

  16. Step 16

    Repeat steps 13–15 with the remaining 3 parathas, using 0.5 tablespoon ghee or butter for each one.

Tools you’ll need

  • large pot
  • colander
  • fork
  • vegetable peeler or paring knife
  • medium mixing bowl
  • wooden spoon or hands for kneading
  • measuring cups
  • measuring spoons
  • small bowls (2)
  • work surface or cutting board
  • rolling pin
  • 12-inch nonstick skillet or griddle
  • metal spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.