Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Palestinian Breakfast Platter

A vibrant, no-cook spread of hummus, labneh, fresh vegetables, olives, and warm pita — the classic Palestinian morning feast. Assemble in 10 minutes and serve family-style.

Total time
10 min
Servings
2
Calories
380
Protein
12g
Palestinian Breakfast Platter
freshwholesomecasualmiddle-easternvegetariancheesechickpeascreamy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spread hummus across a large plate, creating a shallow well in the center with the back of a spoon.

  2. Step 2

    Dollop labneh into the well and drizzle both with olive oil and a pinch of black pepper.

  3. Step 3

    Scatter cucumber, tomato, and olives around the plate in separate clusters.

  4. Step 4

    Sprinkle fresh parsley and mint over the entire platter.

  5. Step 5

    Warm pita in a dry skillet over medium heat 90 seconds per side, or wrap in a damp towel.

  6. Step 6

    Serve pita on the side. Tear and dip into hummus, labneh, and vegetables.

Tools you’ll need

  • large plate or platter
  • spoon
  • skillet (optional, for warming pita)
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.