Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Seared Landjäger with Mustard & Apple

Crispy German smoked sausage paired with quick-pickled apples and whole-grain mustard. Ready in 20 minutes—pure weeknight comfort.

Total time
20 min
Servings
4
Calories
385
Protein
18g
Pan-Seared Landjäger with Mustard & Apple
heartycasualgermanporkcrispytenderweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the apple into thin wedges. Toss with vinegar, mustard, and caraway seeds in a small bowl.

  2. Step 2

    Score the landjäger skin lightly with a knife. Heat a skillet over medium-high heat, no oil needed.

  3. Step 3

    Sear the sausage 2–3 minutes per side until the skin crisps and the center is warm. Shake the pan occasionally.

  4. Step 4

    Toast the rye bread in the same skillet (or toaster) until edges are golden.

  5. Step 5

    Plate the sausage and toast. Spoon pickled apples and mustard over the top, then sprinkle with fresh dill.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • sharp knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.