Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Pancit Canton with Fresh Sides

Stir-fried egg noodles with soy, garlic, and crispy edges, served alongside cool cucumber, tomato, and lettuce for a Filipino weeknight dinner that comes together in one pan.

Total time
20 min
Servings
2
Calories
380
Protein
10g
20-Min Pancit Canton with Fresh Sides
casualcomfortfilipinovegetarianvegetariancrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil noodles in salted water until al dente, then drain completely.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 1 minute.

  3. Step 3

    Add minced garlic and cook 30 seconds until fragrant, then add carrot and cabbage.

  4. Step 4

    Stir-fry until vegetables soften, about 3 minutes, then add cooked noodles and soy sauce.

  5. Step 5

    Toss constantly until noodles are heated through and edges start to crisp, 2–3 minutes.

  6. Step 6

    Divide pancit between plates and arrange cucumber slices, tomato slices, and lettuce alongside.

Tools you’ll need

  • large skillet or wok
  • pot for boiling
  • wooden spoon or tongs
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.