Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pancit Bihon

Filipino stir-fried rice noodles with mixed protein, soy-garlic glaze, and crispy edges — finished in one skillet in under 15 minutes. It's street food, it's dinner, it's TikTok.

Total time
15 min
Servings
4
Calories
385
Protein
32g
Crispy Pancit Bihon
comfortquickfilipinochickenshrimpcrispytenderchewy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Soak rice noodles in hot water for 5 minutes until pliable. Drain and set aside.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering, about 60 seconds.

  3. Step 3

    Add shrimp and cook until pink, stirring often, about 2 minutes. Remove to a plate.

  4. Step 4

    Add garlic to the same skillet, stir until fragrant, 30 seconds. Add carrots and cook for 1 minute.

  5. Step 5

    Pour in noodles, soy sauce, and 1/4 cup water. Toss constantly until noodles are tender and liquid is absorbed, 3–4 minutes.

  6. Step 6

    Return shrimp to skillet with chicken and scallions. Toss until heated through, 1 minute. Serve hot.

Tools you’ll need

  • large skillet (12-inch preferred)
  • wooden spoon or spatula
  • shallow bowl for soaking

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.