Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pansotti con Salsa di Noci

Delicate crescent-shaped pasta pockets filled with ricotta and herbs, draped in a silky walnut sauce. A refined yet achievable Ligurian classic that looks restaurant-worthy but takes just 25 minutes.

Total time
25 min
Servings
2
Calories
620
Protein
18g
Pansotti con Salsa di Noci
elegantsimpleitalianvegetarianvegetariantendercreamysilky

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pulse the walnuts and garlic clove in a food processor until the walnuts are chopped into pieces smaller than a grain of rice — like wet breadcrumbs, about 45 seconds.

  2. Step 2

    Pour the heavy cream into the processor and pulse until the mixture looks like smooth peanut butter with no white cream streaks visible, about 20 seconds.

  3. Step 3

    Add 0.5 teaspoons salt and pulse once to combine, then transfer to a small bowl and set aside.

  4. Step 4

    Spoon the ricotta into a small bowl, then add the basil and 0.25 teaspoons salt and stir with a fork until the basil is evenly mixed throughout.

  5. Step 5

    Lay one wonton wrapper on the cutting board in front of you — it should look like a small square about 3 inches on each side.

  6. Step 6

    Place 1 teaspoon of ricotta filling in the center of the wrapper, keeping it in a small mound away from all four edges.

  7. Step 7

    Dip your finger in a small bowl of water and wipe the water along all four edges of the wrapper — this acts like glue.

  8. Step 8

    Fold the wrapper diagonally in half so the corners meet exactly, forming a triangle, then press the wet edges together firmly so they seal.

  9. Step 9

    Pick up the triangle and bring the two points at the base (the ends of the long edge) together and press them to each other — the triangle should now look like a crescent moon.

  10. Step 10

    Place the finished pansotto on a plate and repeat steps 5 through 9 with the remaining 15 wonton wrappers and filling.

  11. Step 11

    Fill a large pot three-quarters full with water and bring it to a rolling boil over high heat, about 8 minutes, then add 1 teaspoon salt.

  12. Step 12

    Slide all 16 pansotti into the boiling water — they will immediately sink, then float to the surface after about 2 minutes.

  13. Step 13

    Once they float, let them cook for exactly 1 more minute, then carefully lift them out with a slotted spoon into a colander.

  14. Step 14

    Divide the walnut sauce between two serving bowls — about 0.25 cup per bowl.

  15. Step 15

    Arrange 8 pansotti on top of the sauce in each bowl, placing them in a single layer across the surface.

  16. Step 16

    Grind black pepper over each bowl, then serve immediately while the pasta is hot.

Tools you’ll need

  • food processor
  • small bowl
  • fork
  • cutting board
  • small bowl of water
  • large pot
  • slotted spoon
  • colander
  • serving bowls
  • pepper grinder

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.