Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tagliatelle al Tartufo

Silky egg tagliatelle tossed with butter, truffle oil, and Parmigiano-Reggiano for an elegant, minimal dish that tastes far more complicated than it is. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
548
Protein
18g
Tagliatelle al Tartufo
elegantsimpleitalianvegetarianvegetariansilkytendercreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Fill a large pot with 8 cups of water and place it over high heat until large bubbles break the surface constantly, about 8 minutes.

  2. Step 2

    Add 1 teaspoon of salt to the boiling water, then carefully lower the tagliatelle into the pot and stir once to separate the strands.

  3. Step 3

    Cook the pasta, stirring once at the 3-minute mark, until the noodles bend without breaking but still have a slight firmness when you bite one—this should take 6 to 8 minutes total.

  4. Step 4

    Reserve 1 cup of the cooking water by carefully ladling it into a small bowl, then pour the pasta through a colander to drain it completely.

  5. Step 5

    Return the empty pot to medium-low heat and add the 3 tablespoons of butter, letting it melt slowly until it turns golden and fragrant, about 2 minutes.

  6. Step 6

    Pour the drained tagliatelle back into the pot with the butter and toss gently with two forks until every strand is coated, about 1 minute.

  7. Step 7

    Pour in the 1.5 teaspoons of truffle oil, toss again to distribute evenly, then add the reserved cooking water 2 tablespoons at a time, tossing between each addition, until the pasta looks silky and lightly sauced, about 3 minutes.

  8. Step 8

    Remove the pot from heat and stir in the 0.5 cup of grated Parmigiano-Reggiano cheese until it disappears into the pasta.

  9. Step 9

    Taste the pasta and grind fresh black pepper over it until the flavor tastes rich but balanced; adjust with a pinch more salt if needed.

  10. Step 10

    Divide the tagliatelle between two warm bowls and serve immediately while it is still steaming.

Tools you’ll need

  • large pot (at least 6 quarts)
  • colander
  • small bowl
  • two forks
  • wooden spoon
  • ladle
  • microplane grater
  • pepper mill

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.