CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Tagliatelle al Tartufo

Silky egg tagliatelle tossed with butter, truffle oil, and Parmigiano-Reggiano for an elegant, minimal dish that tastes far more complicated than it is. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
548
Protein
18g
Tagliatelle al Tartufo
elegantsimpleitalianvegetarianvegetariansilkytendercreamy

Ingredients

  • 8 oz tagliatelle
  • 3 tablespoons butter
  • 1.5 teaspoons black truffle oil
  • ½ cup Parmigiano-Reggiano cheese, finely grated
  • 1 teaspoon salt
  • ¼ teaspoon black pepper

Instructions

  1. 1

    Fill a large pot with 8 cups of water and place it over high heat until large bubbles break the surface constantly, about 8 minutes.

  2. 2

    Add 1 teaspoon of salt to the boiling water, then carefully lower the tagliatelle into the pot and stir once to separate the strands.

  3. 3

    Cook the pasta, stirring once at the 3-minute mark, until the noodles bend without breaking but still have a slight firmness when you bite one—this should take 6 to 8 minutes total.

  4. 4

    Reserve 1 cup of the cooking water by carefully ladling it into a small bowl, then pour the pasta through a colander to drain it completely.

  5. 5

    Return the empty pot to medium-low heat and add the 3 tablespoons of butter, letting it melt slowly until it turns golden and fragrant, about 2 minutes.

  6. 6

    Pour the drained tagliatelle back into the pot with the butter and toss gently with two forks until every strand is coated, about 1 minute.

  7. 7

    Pour in the 1.5 teaspoons of truffle oil, toss again to distribute evenly, then add the reserved cooking water 2 tablespoons at a time, tossing between each addition, until the pasta looks silky and lightly sauced, about 3 minutes.

  8. 8

    Remove the pot from heat and stir in the 0.5 cup of grated Parmigiano-Reggiano cheese until it disappears into the pasta.

  9. 9

    Taste the pasta and grind fresh black pepper over it until the flavor tastes rich but balanced; adjust with a pinch more salt if needed.

  10. 10

    Divide the tagliatelle between two warm bowls and serve immediately while it is still steaming.

Tools you’ll need

  • large pot (at least 6 quarts)
  • colander
  • small bowl
  • two forks
  • wooden spoon
  • ladle
  • microplane grater
  • pepper mill

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.