Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pasteli (Sesame Brittle)

A crispy, golden Greek sesame brittle made with just honey, sesame seeds, and a pinch of salt. Ready in under 20 minutes with no special equipment needed.

Total time
15 min
Servings
12
Calories
186
Protein
4g
Pasteli (Sesame Brittle)
simplenostalgicgreekvegetarianvegandairy-freecrispycrunchy

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Line a baking sheet with parchment paper, leaving a 1-inch border of paper exposed on all sides so you can grip it later.

  2. Step 2

    Pour the honey into a medium saucepan and place it over medium heat, stirring gently once every 30 seconds until the honey feels warm to the touch and moves easily, about 2–3 minutes.

  3. Step 3

    Pour the sesame seeds into the warm honey and stir constantly using a wooden spoon, scraping the bottom and sides, until every seed is coated and the mixture turns golden-brown like caramel, about 3–4 minutes.

  4. Step 4

    Remove the pan from heat and sprinkle in the salt, stirring once more to combine thoroughly.

  5. Step 5

    Pour the mixture onto the parchment paper in a single layer, spreading it gently with the back of a wooden spoon into an even sheet about 1/4-inch thick.

  6. Step 6

    Let the pasteli cool on the counter until it is completely hard and no longer sticky to the touch, about 8–10 minutes.

  7. Step 7

    Once cool, break the pasteli into roughly 2-inch irregular shards by hand or with a knife, working directly on the parchment paper.

  8. Step 8

    Transfer the shards to an airtight container where they will stay crispy for up to 1 week.

Tools you’ll need

  • baking sheet
  • parchment paper
  • medium saucepan
  • wooden spoon
  • airtight container

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.