Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Patacones con Hogao

Twice-fried green plantain patties served with Colombian tomato-onion sauce. Crispy, savory, and utterly addictive—a street-food classic that takes 20 minutes.

Total time
20 min
Servings
2
Calories
320
Protein
2g
Patacones con Hogao
casualcomfortcolombianvegetarianvegetariancrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Dice the onion and tomatoes into small pieces. Mince the garlic.

  2. Step 2

    Heat 1 tbsp oil in a skillet over medium. Add onion, cook until soft, ~3 minutes.

  3. Step 3

    Add garlic, stir 30 seconds. Add tomatoes, salt, and pepper. Simmer 5 minutes until jammy.

  4. Step 4

    Peel the plantains. Slice crosswise into 1/2-inch-thick rounds.

  5. Step 5

    Heat oil in a deep skillet to 350°F (test: a cube of bread browns in 60 seconds).

  6. Step 6

    Fry plantain rounds in batches 2–3 minutes per side until light golden. Transfer to a plate.

  7. Step 7

    Once cool enough to handle, press each round flat with a tostonera or the bottom of a glass.

  8. Step 8

    Return pressed patacones to oil, fry 90 seconds per side until deep golden and crispy.

  9. Step 9

    Drain patacones on paper towels. Top with warm hogao and serve immediately.

Tools you’ll need

  • cutting board
  • knife
  • deep skillet or large saucepan
  • thermometer (optional but recommended)
  • tostonera or flat-bottomed glass
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.