Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Pepper Steak with Fried Rice

Tender beef strips seared with bell peppers and onions in a silky soy-ginger sauce, served over crispy fried rice. A weeknight stir-fry that tastes like takeout but comes together in one skillet.

Total time
20 min
Servings
2
Calories
520
Protein
38g
20-Min Pepper Steak with Fried Rice
satisfyingquickchinesebeeftendercrispyweeknightstir-fry

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice beef against the grain into thin 1/4-inch strips; pat dry with paper towels.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over high heat until it shimmers, about 60 seconds.

  3. Step 3

    Working in batches, sear beef 90 seconds per side without stirring; transfer to a plate.

  4. Step 4

    Add more oil if needed, then stir-fry peppers and onion until edges soften, about 3 minutes.

  5. Step 5

    Stir in ginger and cook 30 seconds until fragrant, then add soy sauce and return beef to pan.

  6. Step 6

    Toss for 1 minute until everything is coated and hot, then serve over warm fried rice.

Tools you’ll need

  • 12-inch skillet or large wok
  • chef's knife
  • cutting board
  • paper towels
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.