CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Pepper Steak with Fried Rice

Tender beef strips seared with bell peppers and onions in a silky soy-ginger sauce, served over crispy fried rice. A weeknight stir-fry that tastes like takeout but comes together in one skillet.

Total time
20 min
Servings
2
Calories
520
Protein
38g
20-Min Pepper Steak with Fried Rice
satisfyingquickchinesebeeftendercrispyweeknightstir-fry

Ingredients

  • ¾ lb beef sirloin or flank steak
  • 2 medium bell peppers (red and yellow), sliced into strips
  • 1 medium yellow onion, sliced
  • 3 tbsp soy sauce
  • 1 tbsp fresh ginger, minced
  • 2 cups cooked fried rice (leftover or frozen)

Instructions

  1. 1

    Slice beef against the grain into thin 1/4-inch strips; pat dry with paper towels.

  2. 2

    Heat 2 tbsp oil in a large skillet over high heat until it shimmers, about 60 seconds.

  3. 3

    Working in batches, sear beef 90 seconds per side without stirring; transfer to a plate.

  4. 4

    Add more oil if needed, then stir-fry peppers and onion until edges soften, about 3 minutes.

  5. 5

    Stir in ginger and cook 30 seconds until fragrant, then add soy sauce and return beef to pan.

  6. 6

    Toss for 1 minute until everything is coated and hot, then serve over warm fried rice.

Tools you’ll need

  • 12-inch skillet or large wok
  • chef's knife
  • cutting board
  • paper towels
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.