Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Min Pepperoni French Bread Pizza

Slice a baguette lengthwise, top with pizza sauce, mozzarella, and pepperoni, then broil until the cheese melts and bubbles. Crispy crust, melty cheese, salty pepperoni — ready in under 5 minutes.

Total time
5 min
Servings
2
Calories
680
Protein
28g
5-Min Pepperoni French Bread Pizza
quickcasualamericanporkcrispymeltyweeknightsandwich

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat your broiler to high and line a baking sheet with foil.

  2. Step 2

    Slice the baguette in half lengthwise and place cut-side up on the sheet.

  3. Step 3

    Spread pizza sauce evenly over both halves, leaving a 1/2-inch border.

  4. Step 4

    Layer pepperoni slices over the sauce, then top with shredded mozzarella.

  5. Step 5

    Broil 2–3 minutes until cheese is melted and bubbling, edges just starting to brown.

  6. Step 6

    Remove from broiler and let cool 1 minute before slicing and serving.

Tools you’ll need

  • broiler oven
  • baking sheet
  • aluminum foil
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.