Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Minute Tuna Melt

Canned tuna mixed with mayo, piled on an English muffin, topped with melty cheddar, and broiled until golden. Ready in under 5 minutes.

Total time
5 min
Servings
2
Calories
320
Protein
26g
5-Minute Tuna Melt
comfortquickamericanfishcrispymeltyweeknightlunch

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix drained tuna with mayonnaise in a bowl until well combined.

  2. Step 2

    Place muffin halves on a small baking sheet, cut-side up.

  3. Step 3

    Divide tuna mixture evenly between the two muffin halves, spreading it on top.

  4. Step 4

    Top each muffin with cheddar cheese, pressing gently so it sticks.

  5. Step 5

    Broil 4–6 inches from the heat until cheese melts and edges are golden, 2–3 minutes.

Tools you’ll need

  • small mixing bowl
  • baking sheet
  • oven broiler

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.