Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Perkedel: Crispy Potato Croquettes

Golden-fried Indonesian potato croquettes filled with a fragrant onion-garlic center. Crispy outside, creamy inside—a beloved vegetarian side that doubles as a satisfying main with sambal and fresh vegetables.

Total time
45 min
Servings
4
Calories
285
Protein
5g
Perkedel: Crispy Potato Croquettes
comfortsatisfyingindonesianvegetarianvegetariancrispycreamyweeknight

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 2-inch chunks. Boil in salted water until a fork pierces easily, ~15 minutes.

  2. Step 2

    Drain and let cool 5 minutes. Pass through a ricer or mash until completely smooth.

  3. Step 3

    Heat butter in a small skillet over medium. Add shallots, garlic, and chili; cook until softened and fragrant, ~3 minutes.

  4. Step 4

    Fold aromatic mixture into mashed potatoes. Season with salt and white pepper. Let cool to room temperature, ~10 minutes.

  5. Step 5

    Pinch 2 tbsp potato mixture. Press into a ball, flatten slightly into an oval patty. Repeat with remaining mixture—makes ~12 croquettes.

  6. Step 6

    Pour flour onto a plate. Dip each patty in beaten egg, then coat lightly with flour; tap off excess.

  7. Step 7

    Heat oil in a 12-inch skillet over medium-high until shimmering, ~90 seconds. Working in batches, fry croquettes 2–3 minutes per side until deep golden brown.

  8. Step 8

    Transfer to a paper-towel-lined plate. Serve hot with sambal or soy sauce.

Tools you’ll need

  • large pot
  • colander
  • ricer or potato masher
  • small skillet
  • 12-inch skillet
  • instant-read thermometer (optional, for oil temp ~350°F)
  • slotted spoon or spider skimmer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.