Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pesto Mozzarella Melt

Fresh mozzarella, tomato, and pesto on toasted bread with a balsamic glaze drizzle. A melty, flavor-packed Italian sandwich that's ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
420
Protein
16g
Pesto Mozzarella Melt
lightfreshitalianvegetariancheesemeltycrispysoft

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice mozzarella into thin rounds, roughly 1/4-inch thick.

  2. Step 2

    Slice tomato into 1/4-inch-thick rounds.

  3. Step 3

    Spread pesto on both sides of each bread slice.

  4. Step 4

    Layer mozzarella and tomato on two bread slices, then top with remaining bread.

  5. Step 5

    Heat butter in a skillet over medium until foaming, then place sandwiches inside.

  6. Step 6

    Cook until golden and crispy, about 2 minutes per side; mozzarella should be melty.

  7. Step 7

    Slice sandwiches in half diagonally and drizzle balsamic glaze over the top.

Tools you’ll need

  • cutting board
  • chef's knife
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.