Pesto Salmon with Tomato Salsa
Salmon fillets spread with pesto and roasted until flaky, served with fresh cherry tomato salsa. Complete weeknight dinner with bright, herbaceous flavors in under 20 minutes.
- Total time
- 18 min
- Servings
- 2
- Calories
- 480
- Protein
- 42g

freshhealthyamericansalmonflakytenderweeknightmain-dish
Ingredients
- 2 fillets (6 oz each) salmon fillets
- 4 tbsp pesto
- 1.5 cups cherry tomatoes, halved
Instructions
- 1
Preheat oven to 425°F and line a sheet pan with foil or parchment.
- 2
Place salmon skin-side down on the pan, then spread 2 tbsp pesto evenly over each fillet.
- 3
Roast until the thickest part flakes easily with a fork, 12–14 minutes.
- 4
While salmon roasts, toss cherry tomatoes with remaining 1 tbsp pesto, salt, and pepper.
- 5
Serve salmon topped with the pesto tomato salsa.
Tools you’ll need
- sheet pan
- foil or parchment paper
- oven
- small bowl
- spoon or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



