Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet Pan Salmon & Asparagus with Cherry Tomato Salad

Crispy salmon fillet and roasted asparagus on one sheet pan, finished with a bright lemon dressing and a quick cherry tomato salad. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
380
Protein
36g
Sheet Pan Salmon & Asparagus with Cherry Tomato Salad
healthysimpleamericansalmoncrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F and line a sheet pan with parchment paper.

  2. Step 2

    Pat salmon dry, place skin-side down on the pan, drizzle with 1 tbsp olive oil, and season with salt and pepper.

  3. Step 3

    Toss asparagus with 1 tbsp oil, salt, and pepper, then arrange around the salmon.

  4. Step 4

    Roast for 12–14 minutes until salmon flakes easily at the thickest point.

  5. Step 5

    While salmon roasts, toss cherry tomatoes with 2 tbsp lemon juice, 2 tbsp oil, salt, and pepper.

  6. Step 6

    Squeeze remaining lemon over the cooked salmon and asparagus, then serve with the tomato salad alongside.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.