Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pistachio Pesto Casarecce

Creamy, nutty pistachio pesto coats tender casarecce pasta in under 20 minutes. A bright, simple Italian dinner that tastes way more impressive than it is.

Total time
18 min
Servings
2
Calories
680
Protein
22g
Pistachio Pesto Casarecce
simpleelegantitalianvegetarianvegetariancreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil casarecce in salted water until al dente, ~11 minutes. Reserve 0.5 cup pasta water, then drain.

  2. Step 2

    Pulse pistachios, basil, parmesan, lemon zest, 1 tbsp lemon juice, and 3 tbsp olive oil until chunky.

  3. Step 3

    Toss hot pasta with pesto, adding reserved pasta water 1 tbsp at a time until sauce coats noodles.

  4. Step 4

    Fold in halved cherry tomatoes gently. Taste and adjust salt, pepper, and lemon juice as needed.

  5. Step 5

    Serve immediately, drizzling with more olive oil and a pinch of fleur de sel if you have it.

Tools you’ll need

  • large pot
  • food processor or blender
  • large mixing bowl
  • measuring cups and spoons
  • box grater or microplane
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.