Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Polish Pierogi with Caramelized Onions

Tender potato-filled dumplings with crispy edges, topped with golden caramelized onions and sour cream. A comforting Polish classic that looks fancy but is surprisingly doable at home.

Total time
50 min
Servings
2
Calories
520
Protein
14g
Polish Pierogi with Caramelized Onions
comfortcozypolishvegetarianvegetariantendercrispyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 1.5 cups flour into a large mixing bowl, make a well in the center with your fingers, and crack the egg into it.

  2. Step 2

    Add 0.25 cup water and 0.5 teaspoon salt to the egg, then stir with a wooden spoon, gradually mixing flour from the sides until a shaggy dough forms.

  3. Step 3

    Dust your work surface with flour, place the dough on it, and knead by pressing with the heel of your hand, folding the dough back onto itself, and rotating a quarter turn; repeat for 8 minutes until the dough is smooth and elastic, not sticky.

  4. Step 4

    Cover the dough with a clean kitchen towel and let it rest at room temperature while you prepare the filling.

  5. Step 5

    Place the potato in a small pot, cover with cold water, set the pot on the stove over high heat, and bring to a boil.

  6. Step 6

    Reduce the heat to medium and simmer until a fork slides easily through the potato, about 12–15 minutes.

  7. Step 7

    Drain the potato in a colander, wait until cool enough to handle, then peel away the skin with your fingers or a small knife.

  8. Step 8

    Place the peeled potato in a small bowl and mash it with a fork until completely smooth with no lumps, then set aside.

  9. Step 9

    Place the large onion on a cutting board with the root end pointing away from you, slice off the papery skin and root end, then slice the onion lengthwise from top to bottom into thin half-moons, about 1/8 inch thick.

  10. Step 10

    Place a 12-inch skillet on the stove over medium heat, add 2 tablespoons butter, and once it melts and foams, add the sliced onion.

  11. Step 11

    Stir the onion with a wooden spoon once every 30 seconds, cooking until the edges turn deep golden brown, about 12–15 minutes; if it looks dry, add 1 tablespoon water.

  12. Step 12

    Taste a piece—it should be very soft and taste like caramel sugar. Pour the onion onto a plate and set aside.

  13. Step 13

    Dust your work surface with flour again, remove the dough from under the towel, and roll it into a flat disk about 1/8 inch thick using a rolling pin.

  14. Step 14

    Using a 3-inch round cookie cutter or the rim of a glass, cut circles from the dough; gather scraps, re-roll, and cut more until no dough remains.

  15. Step 15

    Place 1 heaping teaspoon of mashed potato in the center of each circle, fold the dough in half to create a half-moon, then press the curved edge firmly with your fingers to seal.

  16. Step 16

    Bring a large pot of salted water to a rolling boil over high heat—the water should bubble vigorously and steam should rise steadily.

  17. Step 17

    Gently lower the pierogi into the boiling water one at a time using a slotted spoon, wait until all of them float to the surface, then cook for 2 minutes more after the last one floats.

  18. Step 18

    Use a slotted spoon to lift each pierogi from the water and transfer it to a plate.

  19. Step 19

    Divide the pierogi between two bowls or plates, top with the caramelized onion, add a dollop of sour cream, and serve immediately.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • work surface (cutting board or counter)
  • kitchen towel
  • small pot
  • colander
  • small bowl
  • fork (for mashing and sealing)
  • cutting board
  • chef's knife
  • 12-inch skillet
  • rolling pin
  • 3-inch round cookie cutter or glass
  • large pot
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.