Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Potato Pierogi with Caramelized Onions

Golden, crispy pan-fried potato-filled dumplings topped with sweet, jammy caramelized onions and sour cream. A weeknight shortcut using wonton wrappers instead of dough—ready in under 20 minutes.

Total time
18 min
Servings
4
Calories
412
Protein
11g
Crispy Potato Pierogi with Caramelized Onions
comfortcozypolishvegetarianvegetariancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium-low. Add onions with a pinch of salt and cook, stirring occasionally, until deep golden and jammy, about 12 minutes.

  2. Step 2

    While onions cook, mix mashed potatoes with cheddar and a pinch of salt and pepper in a bowl.

  3. Step 3

    Lay a wonton wrapper on the counter. Spoon 1 tbsp potato filling into the center. Wet the edges with water, fold into a triangle, then bring the two corners together. Repeat with remaining wrappers.

  4. Step 4

    Transfer caramelized onions to a plate. Add remaining 2 tbsp oil to the skillet over medium-high heat until shimmering.

  5. Step 5

    Working in batches, pan-fry pierogi 90 seconds per side until crispy and golden brown. Do not crowd the pan.

  6. Step 6

    Serve pierogi topped with caramelized onions and a dollop of sour cream.

Tools you’ll need

  • 12-inch skillet
  • mixing bowl
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.