Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Polish Potato & Cheese Pierogi with Caramelized Onions

Tender homemade dumplings filled with mashed potatoes and sharp cheddar, topped with sweet caramelized onions and sour cream. A comforting Polish classic that's easier than it looks.

Total time
50 min
Servings
4
Calories
485
Protein
14g
Polish Potato & Cheese Pierogi with Caramelized Onions
comfortnostalgicpolishvegetariancheesetendercreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Make a well in the center and crack in the egg.

  2. Step 2

    Gradually stir flour into the egg, then knead with your hands until a stiff dough forms, ~3 min.

  3. Step 3

    Cover dough and let rest at room temperature while you prepare filling.

  4. Step 4

    Cut potatoes into 2-inch chunks and boil in salted water until fork-tender, ~12 min.

  5. Step 5

    Drain potatoes and mash with a fork until smooth. Stir in cheese until melted.

  6. Step 6

    Slice onion into thin half-moons. Melt butter in a skillet over medium heat.

  7. Step 7

    Add onions and cook, stirring occasionally, until golden and very soft, ~15 min.

  8. Step 8

    Roll dough thin on a floured surface. Cut into 3-inch circles using a cup or cutter.

  9. Step 9

    Place 1 tbsp filling on each circle, fold in half, and press edges to seal tightly.

  10. Step 10

    Bring a large pot of salted water to a boil. Add pierogi in batches.

  11. Step 11

    Cook until pierogi float, then simmer 2 minutes more. Remove with a slotted spoon.

  12. Step 12

    Serve pierogi topped with caramelized onions and a dollop of sour cream.

Tools you’ll need

  • mixing bowl
  • fork
  • cutting board
  • chef's knife
  • 12-inch skillet
  • large pot
  • slotted spoon
  • measuring spoons
  • measuring cups
  • 3-inch round cutter or cup

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.