Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Potato & Mushroom Pierogi

Tender dough pillows filled with creamy mashed potatoes and earthy sautéed mushrooms, boiled until they float, then pan-fried until golden. A comforting Polish classic.

Total time
50 min
Servings
4
Calories
485
Protein
12g
Potato & Mushroom Pierogi
comfortcozypolishvegetarianvegetariantendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel potatoes and cut into 1-inch chunks. Boil in salted water until fork-tender, ~15 minutes.

  2. Step 2

    Slice mushrooms into quarters. Sauté in 1 tbsp butter over medium-high until liquid evaporates, ~8 minutes.

  3. Step 3

    Drain potatoes. Mash with remaining 3 tbsp butter and salt. Fold in cooled mushrooms.

  4. Step 4

    Mix flour and 0.5 tsp salt in a bowl. Make a well; add eggs and sour cream.

  5. Step 5

    Stir with a fork until a shaggy dough forms. Knead on a floured counter until smooth, ~3 minutes.

  6. Step 6

    Roll dough to 1/8-inch thickness. Cut 3-inch circles with a cup. Place 1 tbsp filling on each.

  7. Step 7

    Fold circle in half. Pinch edges firmly to seal, removing air pockets. Lay on a floured surface.

  8. Step 8

    Bring a large pot of salted water to a boil. Drop pierogi in batches; cook until they float, then 2 minutes more.

  9. Step 9

    Remove with a slotted spoon. Pan-fry in 2 tbsp butter over medium-high until golden edges, ~3 minutes per side.

  10. Step 10

    Serve hot topped with caramelized onions or a dollop of sour cream.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • mixing bowl
  • fork
  • rolling pin
  • 3-inch cup or round cutter
  • slotted spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.