Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Portuguese Custard Tarts

Crispy, buttery phyllo cups filled with silky egg custard and a hint of cinnamon—a fusion of Portuguese tradition meets simple home baking. Ready in under an hour, no special equipment required.

Total time
45 min
Servings
8
Calories
172
Protein
4g
Portuguese Custard Tarts
indulgentelegantportuguesevegetarianeggscrispycreamyflaky

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a muffin tin with 8 paper liners.

  2. Step 2

    Stack phyllo sheets and cut into 16 squares (roughly 4×4 inches each).

  3. Step 3

    Layer 2 phyllo squares per cup, brushing each lightly with melted butter. Press gently into the liners.

  4. Step 4

    Bake phyllo cups 6 minutes until pale golden. Remove and let cool slightly.

  5. Step 5

    Whisk together milk, eggs, sugar, cornstarch, vanilla, and cinnamon in a bowl until smooth.

  6. Step 6

    Pour custard into each phyllo cup, filling three-quarters full. Don't overfill.

  7. Step 7

    Bake 15–18 minutes until custard is set at edges but jiggles slightly in the center.

  8. Step 8

    Cool in the tin 5 minutes, then transfer to a wire rack. Serve warm or at room temperature.

Tools you’ll need

  • muffin tin (12-cup or similar)
  • paper muffin liners
  • small whisk
  • medium bowl
  • pastry brush
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.