Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pressed Mackerel Sushi in 20 Minutes

Fresh mackerel pressed into seasoned sushi rice with a touch of wasabi and soy. No rolling required—just layer, press, slice, and serve.

Total time
20 min
Servings
2
Calories
310
Protein
28g
Pressed Mackerel Sushi in 20 Minutes
elegantfreshjapanesefishtendersilkyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk rice vinegar and sugar together until sugar dissolves, then fold into cooled sushi rice with a gentle hand.

  2. Step 2

    Spread half the seasoned rice into the bottom of a small square or rectangular mold (or a loaf pan lined with plastic wrap).

  3. Step 3

    Lay mackerel slices across the rice layer, then top with remaining rice. Press down firmly with your palm for 10 seconds.

  4. Step 4

    Invert the mold onto a cutting board and carefully remove the frame. The sushi block should hold its shape.

  5. Step 5

    Using a very sharp, wet knife, slice the block into 6–8 pieces with one smooth downward cut per slice—don't saw.

  6. Step 6

    Arrange pieces on a plate, dab a tiny amount of wasabi on each, and serve with soy sauce on the side.

Tools you’ll need

  • small square or rectangular mold (2–3 cup capacity, or loaf pan)
  • plastic wrap
  • cutting board
  • sharp sushi or chef's knife
  • small bowl for mixing vinegar and sugar

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.