CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pressed Mackerel Sushi in 20 Minutes

Fresh mackerel pressed into seasoned sushi rice with a touch of wasabi and soy. No rolling required—just layer, press, slice, and serve.

Total time
20 min
Servings
2
Calories
310
Protein
28g
Pressed Mackerel Sushi in 20 Minutes
elegantfreshjapanesefishtendersilkyweeknightdate-night

Ingredients

  • 1.5 cups sushi rice (cooked and cooled)
  • 8 oz mackerel fillet, sashimi-grade
  • 2 tbsp rice vinegar
  • ½ tsp sugar
  • 1 tsp wasabi
  • ¼ cup soy sauce for serving

Instructions

  1. 1

    Whisk rice vinegar and sugar together until sugar dissolves, then fold into cooled sushi rice with a gentle hand.

  2. 2

    Spread half the seasoned rice into the bottom of a small square or rectangular mold (or a loaf pan lined with plastic wrap).

  3. 3

    Lay mackerel slices across the rice layer, then top with remaining rice. Press down firmly with your palm for 10 seconds.

  4. 4

    Invert the mold onto a cutting board and carefully remove the frame. The sushi block should hold its shape.

  5. 5

    Using a very sharp, wet knife, slice the block into 6–8 pieces with one smooth downward cut per slice—don't saw.

  6. 6

    Arrange pieces on a plate, dab a tiny amount of wasabi on each, and serve with soy sauce on the side.

Tools you’ll need

  • small square or rectangular mold (2–3 cup capacity, or loaf pan)
  • plastic wrap
  • cutting board
  • sharp sushi or chef's knife
  • small bowl for mixing vinegar and sugar

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.