Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Whole Fish with Garlic & Calamansi

Whole fish fried golden and crackling, finished with a sharp garlic-calamansi punch. Classic Filipino dinner that tastes restaurant-perfect in 15 minutes.

Total time
15 min
Servings
2
Calories
385
Protein
32g
Crispy Whole Fish with Garlic & Calamansi
casualsatisfyingfilipinofishcrispytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Season fish inside and out with salt and pepper. Dust both sides lightly with flour.

  2. Step 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Carefully slide fish into hot oil. Fry without moving for 5–6 minutes until skin is golden and crisp.

  4. Step 4

    Flip fish gently. Fry the other side 4–5 minutes until golden and flesh flakes easily.

  5. Step 5

    Transfer fish to a plate. Pour off all but 1 tbsp oil. Add minced garlic and cook 30 seconds until fragrant.

  6. Step 6

    Drizzle fish with fish sauce and squeeze calamansi over top. Serve immediately with the garlic oil.

Tools you’ll need

  • large skillet (12-inch)
  • paper towels
  • spatula or fish turner

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.