CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Prawn Laksa with Crispy Chili Oil

Silky coconut curry broth with quick-seared prawns, rice noodles, and crispy chili oil. No long simmers—just bold laksa flavor in under 20 minutes.

Total time
20 min
Servings
4
Calories
420
Protein
28g
20-Min Prawn Laksa with Crispy Chili Oil
comfortboldmalaysianshrimpsilkytenderweeknightmeal-prep

Ingredients

  • 1 lb large prawns (peeled & deveined)
  • 3 tbsp laksa paste (Malaysian red curry base)
  • 13.5 oz coconut milk
  • 2 cups chicken or vegetable broth
  • 8 oz fresh rice noodles (or dried, softened)
  • 1 cup fresh lettuce (torn, for serving)
  • 3 tbsp chili oil or sambal (store-bought or homemade)
  • 1 whole lime (for juice)

Instructions

  1. 1

    Bring broth to a simmer in a large pot over medium heat, then stir in laksa paste until smooth.

  2. 2

    Pour in coconut milk and stir well. Taste and adjust salt—the broth should be rich and aromatic.

  3. 3

    Add rice noodles directly to the simmering broth and cook until tender, 3–4 minutes if fresh (or follow package time if dried).

  4. 4

    While noodles cook, pat prawns dry and season with salt. Heat a skillet over medium-high until very hot.

  5. 5

    Sear prawns 90 seconds per side without moving—they should be pink and opaque inside.

  6. 6

    Divide noodles and broth into bowls, top with prawns, torn lettuce, and a generous drizzle of chili oil. Squeeze lime over top and serve hot.

Tools you’ll need

  • large pot (4–5 quart)
  • 12-inch skillet
  • spoon or wooden spoon
  • tongs
  • four serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.