Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Prawn Laksa with Crispy Chili Oil

Silky coconut curry broth with quick-seared prawns, rice noodles, and crispy chili oil. No long simmers—just bold laksa flavor in under 20 minutes.

Total time
20 min
Servings
4
Calories
420
Protein
28g
20-Min Prawn Laksa with Crispy Chili Oil
comfortboldmalaysianshrimpsilkytenderweeknightmeal-prep

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring broth to a simmer in a large pot over medium heat, then stir in laksa paste until smooth.

  2. Step 2

    Pour in coconut milk and stir well. Taste and adjust salt—the broth should be rich and aromatic.

  3. Step 3

    Add rice noodles directly to the simmering broth and cook until tender, 3–4 minutes if fresh (or follow package time if dried).

  4. Step 4

    While noodles cook, pat prawns dry and season with salt. Heat a skillet over medium-high until very hot.

  5. Step 5

    Sear prawns 90 seconds per side without moving—they should be pink and opaque inside.

  6. Step 6

    Divide noodles and broth into bowls, top with prawns, torn lettuce, and a generous drizzle of chili oil. Squeeze lime over top and serve hot.

Tools you’ll need

  • large pot (4–5 quart)
  • 12-inch skillet
  • spoon or wooden spoon
  • tongs
  • four serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.