Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Nasi Kandar

Malaysian street-food rice with aromatic spices, tender chicken and shrimp, and a silky coconut-curry sauce. Ready in 20 minutes with pantry staples and cooked rice.

Total time
20 min
Servings
2
Calories
485
Protein
28g
Quick Nasi Kandar
comfortquickmalaysianchickenshrimptenderfluffyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the onion lengthwise from root to tip into thin half-moons about 1/8-inch wide, like cutting an apple in half and then thinly slicing each half.

  2. Step 2

    Cut the chicken thigh crosswise (against the grain) into 1/2-inch-thick strips, roughly the size of your pinky finger.

  3. Step 3

    Heat 1 tablespoon of olive oil in a large skillet over medium-high heat until it shimmers and moves quickly when you tilt the pan, about 90 seconds.

  4. Step 4

    Add the onion slices and stir constantly until they soften and turn translucent, about 2 minutes, so they release their sweetness.

  5. Step 5

    Sprinkle the curry powder over the onions and stir constantly for 30 seconds until the powder becomes fragrant and coats everything.

  6. Step 6

    Add the chicken strips and stir constantly over medium-high heat until the outside turns opaque and no raw pink remains, about 3 minutes.

  7. Step 7

    Add the shrimp and stir constantly until they turn from gray to pink and opaque throughout, about 2 minutes.

  8. Step 8

    Pour in the coconut milk and stir until everything is evenly coated, then reduce heat to medium and simmer for 2 minutes to blend flavors.

  9. Step 9

    Divide the cooked rice between two bowls, mounding it in the center of each.

  10. Step 10

    Spoon the chicken, shrimp, and sauce over the rice, pouring any extra sauce over the top.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • cutting board
  • chef's knife
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.