Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Seafood Laksa

A vibrant, aromatic coconut seafood soup built in one pot using laksa paste and fresh shrimp. Ready in 20 minutes with bold spice and tender seafood.

Total time
20 min
Servings
2
Calories
320
Protein
28g
Quick Seafood Laksa
comfortboldthaishrimpsilkytenderweeknightsoup

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour the coconut milk and broth into a large pot and place it on the stovetop over medium-high heat.

  2. Step 2

    Add the laksa paste to the pot and whisk it into the liquid until completely smooth with no lumps, about 1 minute.

  3. Step 3

    Bring the mixture to a gentle simmer — you should see small bubbles breaking the surface regularly — then reduce heat to medium.

  4. Step 4

    Add the shrimp to the simmering broth, stirring gently once or twice so they cook evenly.

  5. Step 5

    Let the shrimp cook in the simmering broth until they turn pink and opaque throughout, about 4–5 minutes.

  6. Step 6

    Squeeze the juice from both lime halves into the pot and stir to distribute the juice evenly.

  7. Step 7

    Taste the broth and add a pinch of salt and pepper if needed, then pour the laksa into serving bowls.

Tools you’ll need

  • large pot (4-quart minimum)
  • wooden spoon or silicone spatula
  • whisk
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.