Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Ravioli with Ricotta and Brown Butter

Store-bought ravioli filled with creamy ricotta, finished with nutty brown butter and fresh sage. Dinner ready in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Ravioli with Ricotta and Brown Butter
comfortsimpleitalianvegetarianvegetariantendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Fill a large pot with water and set it over high heat until the water reaches a rolling boil with large, continuous bubbles breaking the surface, about 8 minutes.

  2. Step 2

    While the water heats, place the butter in a small skillet over medium-low heat and add the garlic clove and sage leaves to the cold butter.

  3. Step 3

    Cook the butter over medium-low heat without stirring for 6–7 minutes, watching until the milk solids at the bottom turn golden brown and smell nutty and toasted.

  4. Step 4

    Once the water boils, add 1 teaspoon of salt, then carefully place the ravioli into the pot so they don't stick to the bottom.

  5. Step 5

    Stir the ravioli gently once with a wooden spoon, then cook for 3–4 minutes until the ravioli float to the surface and stay there for 30 seconds.

  6. Step 6

    Remove the garlic clove and sage leaves from the brown butter skillet using a slotted spoon.

  7. Step 7

    Using a slotted spoon, transfer the cooked ravioli directly from the pot to the skillet with the brown butter, leaving pasta water behind.

  8. Step 8

    Tilt the skillet gently so the brown butter coats all the ravioli, then sprinkle with 0.25 teaspoon black pepper.

  9. Step 9

    Divide the ravioli and brown butter between two plates, then top each with a small piece of the cooked sage leaf and the reserved cooked garlic clove if desired.

Tools you’ll need

  • large pot (at least 3-quart capacity)
  • small skillet (8–10 inches)
  • wooden spoon
  • slotted spoon
  • two serving plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.