CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Rigatoni Alla Vodka

Creamy tomato-vodka pasta ready in 20 minutes. San Marzano tomatoes and a splash of vodka create a rich, silky sauce that clings to every piece of rigatoni.

Total time
20 min
Servings
4
Calories
520
Protein
18g
20-Min Rigatoni Alla Vodka
comfortitalianvegetarianvegetariancreamytenderweeknightpasta

Ingredients

  • 1 lb rigatoni
  • 28 oz canned San Marzano tomatoes
  • ½ cup vodka
  • ½ cup heavy cream
  • ¾ cup parmesan cheese, grated
  • ¼ tsp red pepper flakes (optional)

Instructions

  1. 1

    Boil rigatoni in salted water until al dente, about 9 minutes. Reserve 1 cup pasta water before draining.

  2. 2

    In the same pot, stir tomatoes with vodka and bring to a boil over medium-high heat, crushing tomatoes with spoon.

  3. 3

    Reduce heat to medium. Simmer 3 minutes until vodka smell mellows, then stir in cream, cheese, and pepper flakes.

  4. 4

    Return rigatoni to pot and toss, adding pasta water 1/4 cup at a time until sauce coats noodles and looks silky.

  5. 5

    Taste for salt and pepper. Serve immediately with extra parmesan on top.

Tools you’ll need

  • large pot with lid
  • wooden spoon
  • measuring cups and spoons
  • colander
  • grater (for parmesan)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.