Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Rigatoni Alla Vodka

Creamy tomato-vodka pasta ready in 20 minutes. San Marzano tomatoes and a splash of vodka create a rich, silky sauce that clings to every piece of rigatoni.

Total time
20 min
Servings
4
Calories
520
Protein
18g
20-Min Rigatoni Alla Vodka
comfortitalianvegetarianvegetariancreamytenderweeknightpasta

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil rigatoni in salted water until al dente, about 9 minutes. Reserve 1 cup pasta water before draining.

  2. Step 2

    In the same pot, stir tomatoes with vodka and bring to a boil over medium-high heat, crushing tomatoes with spoon.

  3. Step 3

    Reduce heat to medium. Simmer 3 minutes until vodka smell mellows, then stir in cream, cheese, and pepper flakes.

  4. Step 4

    Return rigatoni to pot and toss, adding pasta water 1/4 cup at a time until sauce coats noodles and looks silky.

  5. Step 5

    Taste for salt and pepper. Serve immediately with extra parmesan on top.

Tools you’ll need

  • large pot with lid
  • wooden spoon
  • measuring cups and spoons
  • colander
  • grater (for parmesan)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.