Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sara Udon with Crispy Shrimp

Quick-fried ramen noodles topped with crispy shrimp, scallions, and a silky egg ribbons in a savory udon broth. Restaurant-quality in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
28g
Sara Udon with Crispy Shrimp
satisfyingquickjapaneseshrimpcrispytenderweeknightpasta

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a pot. Cook ramen until just al dente, ~3 minutes. Drain and set aside.

  2. Step 2

    Pat shrimp dry with paper towels. Season with salt and pepper.

  3. Step 3

    In a small bowl, whisk together dashi, soy sauce, and mirin. Set aside.

  4. Step 4

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, ~60 seconds.

  5. Step 5

    Add shrimp in a single layer. Sear without stirring for 90 seconds until edges curl and turn pink.

  6. Step 6

    Flip shrimp and cook 60 seconds more until opaque. Transfer to a plate.

  7. Step 7

    In the same skillet, add cooked ramen. Spread in a single layer and cook undisturbed for 90 seconds.

  8. Step 8

    Toss ramen to crisp all sides, cooking 60 seconds more until golden and crunchy edges form.

  9. Step 9

    Pour broth mixture over ramen. Stir to coat evenly and bring to a gentle simmer, ~60 seconds.

  10. Step 10

    Push ramen to the edges of the skillet. Pour beaten eggs into the center and scramble until set, ~90 seconds.

  11. Step 11

    Divide noodles between two bowls. Top with crispy shrimp, egg ribbons, and scallions.

  12. Step 12

    Drizzle any remaining broth over the top and serve immediately.

Tools you’ll need

  • pot
  • large skillet (12-inch)
  • small bowl
  • whisk
  • paper towels
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.