Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Sate Madura with Lontong & Crispy Shallots

Charred chicken skewers with a punchy peanut sauce, served over soft lontong and topped with fried shallots—a Madurese classic that tastes like it took hours but comes together in 20 minutes.

Total time
25 min
Servings
2
Calories
510
Protein
38g
25-Min Sate Madura with Lontong & Crispy Shallots
comfortsatisfyingindonesianchickencrispytendercreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Thread chicken cubes onto metal skewers, dividing evenly between 4 skewers.

  2. Step 2

    Whisk peanut butter, soy sauce, lime juice, brown sugar, garlic, and 1/4 cup water until smooth.

  3. Step 3

    Heat a grill pan or cast-iron skillet over high heat until it smokes lightly, about 90 seconds.

  4. Step 4

    Lay skewers in the hot pan without moving for 3 minutes until charred, then flip and cook 2 minutes more.

  5. Step 5

    Warm lontong slices in the same pan for 1 minute per side, then divide between two plates.

  6. Step 6

    Drizzle peanut sauce over lontong, nestle skewers on top, and sprinkle generously with fried shallots.

Tools you’ll need

  • 4 metal skewers (or bamboo, soaked 30 minutes)
  • 12-inch cast-iron skillet or grill pan
  • Small bowl or measuring cup
  • Whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.