Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Sate Madura with Peanut Sauce

Indonesian street-food satay with tender chicken, rich peanut sauce, and crispy shallot-chili garnish. Grilled skewers and warm sauce ready in one quick session.

Total time
15 min
Servings
2
Calories
520
Protein
48g
15-Min Sate Madura with Peanut Sauce
casualsatisfyingindonesianchickencrispytendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut chicken into 1-inch cubes and thread onto wooden skewers, spacing evenly.

  2. Step 2

    Heat a grill pan or skillet over medium-high until water flicks sizzle on contact.

  3. Step 3

    Grill skewers 3 minutes per side until charred edges appear and meat is cooked through.

  4. Step 4

    While meat cooks, whisk peanut butter and coconut milk in a bowl until smooth, then add salt and pepper to taste.

  5. Step 5

    Warm peanut sauce in a small skillet for 2 minutes over low heat, stirring often.

  6. Step 6

    Plate skewers, drizzle with warm peanut sauce, top with crispy shallots and fresh chili, and squeeze lime over.

Tools you’ll need

  • wooden skewers (4–6)
  • grill pan or 12-inch skillet
  • small mixing bowl
  • whisk
  • small saucepan

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.