CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Sate Madura with Peanut Sauce

Indonesian street-food satay with tender chicken, rich peanut sauce, and crispy shallot-chili garnish. Grilled skewers and warm sauce ready in one quick session.

Total time
15 min
Servings
2
Calories
520
Protein
48g
15-Min Sate Madura with Peanut Sauce
casualsatisfyingindonesianchickencrispytendercreamyweeknight

Ingredients

  • 1 lb boneless, skinless chicken breasts
  • ½ cup natural peanut butter
  • ¼ cup coconut milk
  • 2 medium shallots, thinly sliced
  • 1 whole Thai chili, sliced
  • 1 whole lime

Instructions

  1. 1

    Cut chicken into 1-inch cubes and thread onto wooden skewers, spacing evenly.

  2. 2

    Heat a grill pan or skillet over medium-high until water flicks sizzle on contact.

  3. 3

    Grill skewers 3 minutes per side until charred edges appear and meat is cooked through.

  4. 4

    While meat cooks, whisk peanut butter and coconut milk in a bowl until smooth, then add salt and pepper to taste.

  5. 5

    Warm peanut sauce in a small skillet for 2 minutes over low heat, stirring often.

  6. 6

    Plate skewers, drizzle with warm peanut sauce, top with crispy shallots and fresh chili, and squeeze lime over.

Tools you’ll need

  • wooden skewers (4–6)
  • grill pan or 12-inch skillet
  • small mixing bowl
  • whisk
  • small saucepan

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.