Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Sausage Penne

Browned Italian sausage simmered with marinara, tossed with penne and finished with a hit of parmesan. Weeknight comfort in one skillet.

Total time
20 min
Servings
4
Calories
680
Protein
38g
20-Min Sausage Penne
comfortamericanporktendercreamyweeknightpastadinner

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet over high heat, then add penne and cook until al dente, ~9 minutes.

  2. Step 2

    While pasta cooks, brown sausage in a separate skillet over medium-high, breaking it apart with a spoon, ~5 minutes.

  3. Step 3

    Pour marinara into the sausage skillet and simmer for 3 minutes until fragrant.

  4. Step 4

    Drain pasta, transfer to the sausage skillet, and toss until coated.

  5. Step 5

    Top each serving with a generous handful of parmesan and serve hot.

Tools you’ll need

  • large skillet or large pot
  • separate medium skillet
  • wooden spoon
  • colander
  • tongs or long spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.