Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Senfeier (Mustard Eggs)

Creamy German comfort food: hard-boiled eggs in a rich mustard-butter sauce, traditionally served with boiled potatoes. A classic Swabian dish that's simple, satisfying, and ready in 30 minutes.

Total time
25 min
Servings
4
Calories
285
Protein
14g
Senfeier (Mustard Eggs)
comfortcozygermanvegetarianeggscreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place eggs in a pot, cover with cold water, and bring to a boil.

  2. Step 2

    Once boiling, remove from heat, cover, and let sit 10 minutes.

  3. Step 3

    Transfer eggs to ice water, cool for 2 minutes, then peel and halve.

  4. Step 4

    Melt butter in a large saucepan over medium heat, ~1 minute.

  5. Step 5

    Whisk in flour to form a roux, cooking until light golden, ~2 minutes.

  6. Step 6

    Gradually whisk in broth, stirring constantly until smooth and thickened.

  7. Step 7

    Stir in mustard until fully combined; sauce should smell tangy and fragrant.

  8. Step 8

    Gently add egg halves and simmer 2 minutes to warm through.

  9. Step 9

    Season with salt and pepper to taste.

  10. Step 10

    Transfer to a serving dish and pour sauce over eggs. Serve hot.

Tools you’ll need

  • large pot
  • ice bath (bowl + ice water)
  • large saucepan
  • whisk
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.