Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Papa a la Huancaína — 25-Minute Shortcut

Boiled potatoes cloaked in a vibrant yellow ají amarillo sauce made with cashews and evaporated milk. Topped with hard-boiled eggs and olives — the Peruvian comfort classic, streamlined for a weeknight.

Total time
25 min
Servings
4
Calories
485
Protein
16g
Papa a la Huancaína — 25-Minute Shortcut
comfortwholesomeperuvianvegetarianeggscreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes in salted water until fork-tender, about 15 minutes. In the last 4 minutes, add eggs.

  2. Step 2

    While they cook, blend ají amarillo paste, cashews, evaporated milk, and 1/2 tsp salt until smooth and pourable.

  3. Step 3

    Drain potatoes and eggs. Peel eggs under cool water, then halve them.

  4. Step 4

    Arrange warm potatoes on a platter. Pour sauce over the top until potatoes are mostly covered.

  5. Step 5

    Scatter egg halves, olives, crumbled queso, and cilantro over the sauce.

  6. Step 6

    Serve warm. Sauce should be glossy and cling to each potato.

Tools you’ll need

  • large pot with lid
  • blender or food processor
  • colander
  • cutting board
  • serving platter

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.