Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Sesame Ginger Soba Bowl

Chilled soba noodles tossed in a punchy ginger-sesame dressing with crisp raw carrots and fresh garlic. Zero cooking except the noodles—ready in 10 minutes.

Total time
10 min
Servings
2
Calories
385
Protein
10g
10-Min Sesame Ginger Soba Bowl
freshlightjapanesevegetariandairy-freechewycrispysmooth

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil soba in salted water until just tender, about 4 minutes. Drain and rinse under cold water until cool.

  2. Step 2

    Whisk together sesame oil, soy sauce, minced ginger, and minced garlic in a large bowl.

  3. Step 3

    Add cooled noodles and shredded carrots to the dressing. Toss until every strand is coated.

  4. Step 4

    Divide between bowls and serve cold or at room temperature.

Tools you’ll need

  • large pot
  • colander
  • large mixing bowl
  • whisk
  • microplane or box grater

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.