Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Shakshuka with Crispy Toast

Poached eggs in a bright, garlicky tomato sauce — the Mediterranean breakfast that doubles as dinner. Serve with crusty toast for dipping.

Total time
18 min
Servings
2
Calories
285
Protein
11g
20-Min Shakshuka with Crispy Toast
comfortsimplemediterraneanvegetarianeggssilkytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a 10-inch skillet over medium. Add garlic and cook 30 seconds until fragrant.

  2. Step 2

    Pour in tomatoes and a pinch of salt. Simmer 6 minutes, stirring occasionally, until sauce thickens slightly.

  3. Step 3

    Create 4 small wells in the sauce. Crack an egg into each, keeping yolks intact. Cover and cook 5–6 minutes until whites set but yolks jiggle.

  4. Step 4

    While eggs cook, toast bread until edges are golden and surface crisps.

  5. Step 5

    Scatter basil over the skillet. Serve with toasted bread alongside for dipping.

Tools you’ll need

  • 10-inch skillet with lid
  • wooden spoon or spatula
  • toaster

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.