Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Shanghai Chili Crisp Shrimp

Tender shrimp tossed in a glossy garlic-ginger sauce with a hit of chili crisp and a finishing splash of Shaoxing wine. One skillet, 15 minutes, pure umami.

Total time
15 min
Servings
2
Calories
245
Protein
28g
Shanghai Chili Crisp Shrimp
quicksatisfyingchineseshrimptenderjuicyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat shrimp dry with a paper towel. Season generously with salt and pepper.

  2. Step 2

    Heat 2 tbsp neutral oil in a 12-inch skillet over medium-high until shimmering, about 90 seconds.

  3. Step 3

    Add shrimp and sear without stirring for 90 seconds until the bottoms turn opaque and pink.

  4. Step 4

    Flip shrimp and cook 60 more seconds. Transfer to a plate.

  5. Step 5

    Add garlic and ginger to the same skillet. Stir constantly for 30 seconds until fragrant.

  6. Step 6

    Pour in Shaoxing wine, scraping up any browned bits. Return shrimp to the pan and toss with chili crisp for 60 seconds.

  7. Step 7

    Remove from heat. Scatter scallions over the top and serve immediately over rice or noodles.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • paper towels
  • wooden spoon or silicone spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.