Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Alambre — Beef, Peppers & Cheese

Skewered beef, peppers, and onions roasted until charred, then topped with melted cheese and served with salsa. One pan, 25 minutes, pure Mexican street food comfort.

Total time
25 min
Servings
2
Calories
520
Protein
48g
Sheet-Pan Alambre — Beef, Peppers & Cheese
casualsatisfyingmexicanbeefcharredtendermeltyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 450°F. Thread beef, pepper, and onion onto metal skewers, alternating pieces.

  2. Step 2

    Brush skewers with oil. Season generously with salt and black pepper on all sides.

  3. Step 3

    Lay skewers flat on a sheet pan. Roast for 12 minutes until beef browns and peppers blister.

  4. Step 4

    Remove from oven. Layer cheese slices over the beef and peppers on each skewer.

  5. Step 5

    Return to oven for 2–3 minutes until cheese melts and edges brown slightly.

  6. Step 6

    Top with jalapeño slices. Serve hot with salsa on the side for dipping.

Tools you’ll need

  • sheet pan
  • metal skewers
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.